PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G35490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 196aa    MW: 21469.8 Da    PI: 7.5712
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G35490.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM78.31.7e-24221478126
           NAM   8 hPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k....kvkaeekewyfFskrdkkyatgkrknr.atksgyWkatgkdkevlsk..k 96 
                   hPtd+elv++yL+++ve+ k+   ++++e+d+y ++P+dL  k     +  ++  wyfF++ + k++ g+r+ r + ++g W++    k+v+    +
  OB01G35490.1  22 HPTDQELVTKYLRRHVESGKNLW-RFVHEADVYAADPEDLTtKyapaVAGDGSAAWYFFTTVRPKSEGGQRRARaVGDDGCWHSEAGAKDVVLGvpS 117
                   9*****************99666.89**************84356633333566********************55569****99999999987677 PP

           NAM  97 gelvglkktLvfykgrapkgektdWvmhey 126
                    + +g ++ + f ++r+ + ++t W+m e 
  OB01G35490.1 118 PRPIGRRQAFSFVTKRDGQRVRTGWIMVEI 147
                   888************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100531.82215169IPR003441NAC domain
SuperFamilySSF1019413.92E-3419169IPR003441NAC domain
PfamPF023653.6E-1521146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MAASSSSSRP DEEEPSGDFW SHPTDQELVT KYLRRHVESG KNLWRFVHEA DVYAADPEDL  60
TTKYAPAVAG DGSAAWYFFT TVRPKSEGGQ RRARAVGDDG CWHSEAGAKD VVLGVPSPRP  120
IGRRQAFSFV TKRDGQRVRT GWIMVEIGLG YAQQDVSSNE LVLCKVYRSP RARPAATKSK  180
TADEPASDDV KPAVAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-131916719166Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646197.11e-143PREDICTED: NAC domain-containing protein 41-like
TrEMBLJ3L2U31e-143J3L2U3_ORYBR; Uncharacterized protein
STRINGOB01G35490.11e-142(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40112972
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.18e-19NAC domain containing protein 35